PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G40330.1
Common NameATMYB23, ATMYBRTF, MPO12.5, MYB23
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 219aa    MW: 24943.5 Da    PI: 9.4055
Description myb domain protein 23
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G40330.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.21.9e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT eEd++l d+v+ +G g+W++Ia++ g++R++k+c++rw +yl
      AT5G40330.1 14 KGLWTVEEDKILMDYVRTHGQGHWNRIAKKTGLKRCGKSCRLRWMNYL 61
                     678*******************************************97 PP

2Myb_DNA-binding60.34.2e-1967112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T +E++l+++++k+lG++ W++Ia++++ gRt++q+k++w+++l
      AT5G40330.1  67 RGNFTDQEEDLIIRLHKLLGNR-WSLIAKRVP-GRTDNQVKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.72961IPR017930Myb domain
SuperFamilySSF466894.58E-3112108IPR009057Homeodomain-like
SMARTSM007172.9E-151363IPR001005SANT/Myb domain
PfamPF002496.6E-171461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.8E-251568IPR009057Homeodomain-like
CDDcd001671.75E-121761No hitNo description
PROSITE profilePS5129427.72462116IPR017930Myb domain
SMARTSM007172.1E-1866114IPR001005SANT/Myb domain
PfamPF002496.9E-1867112IPR001005SANT/Myb domain
CDDcd001676.32E-1469112No hitNo description
Gene3DG3DSA:1.10.10.604.2E-2769116IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0010053Biological Processroot epidermal cell differentiation
GO:0010091Biological Processtrichome branching
GO:0048629Biological Processtrichome patterning
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000263anatomynon-hair root epidermal cell
PO:0000293anatomyguard cell
PO:0006504anatomyleaf trichome
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0020038anatomypetiole
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MRMTRDGKEH EYKKGLWTVE EDKILMDYVR THGQGHWNRI AKKTGLKRCG KSCRLRWMNY  60
LSPNVNRGNF TDQEEDLIIR LHKLLGNRWS LIAKRVPGRT DNQVKNYWNT HLSKKLGLGD  120
HSTAVKAACG VESPPSMALI TTTSSSHQEI SGGKNSTLRF DTLVDESKLK PKSKLVHATP  180
TDVEVAATVP NLFDTFWVLE DDFELSSLTM MDFTNGYCL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28141167108B-MYB
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306935810.0
Genevisible249408_at0.0
Expression AtlasAT5G40330-
AtGenExpressAT5G40330-
ATTED-IIAT5G40330-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: First expressed in leaf primordia. Later confined to developing trichome cells where it persists at high levels throughout all stages of trichome development. {ECO:0000269|PubMed:11437443, ECO:0000269|PubMed:15728674}.
UniprotTISSUE SPECIFICITY: Expressed in roots, seed coats, leaves, stems and flowers. Detected specifically in trichomes, and in the cell division and differentiation zone of the root. {ECO:0000269|PubMed:11437443}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a MYB gene that, when overexpressed ectopically, can induce ectopic trichome formation. It is a member of subgroup 15, together with WER and GL1. Members of this subgroup share a conserved motif of 19 amino acids in the putative transcription activation domain at the C-terminal end. The gene is expressed in leaves, stems, flowers, seeds and roots and quite strongly in trichomes. There is partial functional redundancy between ATMYB23 and GL1. The two proteins are functionally equivalent with respect to the regulation of trichome initiation but not with respect to trichome branching - which is controlled by MYB23 and not GL1.
UniProtTranscription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Regulates the epidermal cell fate specification. Mediates the formation of columellae and accumulation of mucilages on seed coats. Controls the elongation of epidermal cells positively in roots but negatively in stems, leading to the promotion of primary roots elongation and repression of leaves and stems elongation, respectively. Ovoids ectopic root-hair formation, probably by inducing GL2 in roots. Controls trichome initiation and branching. {ECO:0000269|PubMed:11437443, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15668208, ECO:0000269|PubMed:15728674}.
Function -- GeneRIF ? help Back to Top
  1. MYB23 participates in a positive feedback loop to reinforce cell fate decisions and ensure robust establishment of the cell type pattern in the Arabidopsis root epidermis.
    [PMID: 19395683]
  2. MYB23 showed a pattern of low expression in pavement cells, medium in basal cells and high expression in trichomes.
    [PMID: 20101514]
  3. MYB23 acquired a specific function for trichome differentiation during evolution.
    [PMID: 22738953]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00538DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G40330.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT2G46410 (R), AT5G14750 (A), AT5G40330 (A)
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G79840(A), AT2G46410(A), AT5G40330(A), AT5G53200(A)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDJasmonic acid
Interaction -- BIND ? help Back to Top
Source Intact With Description
BINDAT1G63650EGL3 interacts with AtMYB23.
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G41315, AT5G53200, AT1G32640, AT1G63650, AT1G79840
IntActSearch Q96276
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G40330
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5196310.0AY519631.1 Arabidopsis thaliana MYB transcription factor (At5g40330) mRNA, complete cds.
GenBankBT0252850.0BT025285.1 Arabidopsis thaliana At5g40330 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_198849.11e-165transcription factor MYB23
SwissprotQ962761e-167MYB23_ARATH; Transcription factor MYB23
TrEMBLR0F1W91e-149R0F1W9_9BRAS; Uncharacterized protein
STRINGAT5G40330.11e-164(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Kirik V, et al.
    Ectopic expression of the Arabidopsis AtMYB23 gene induces differentiation of trichome cells.
    Dev. Biol., 2001. 235(2): p. 366-77
    [PMID:11437443]
  3. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  4. Abe H, et al.
    Arabidopsis AtMYC2 (bHLH) and AtMYB2 (MYB) function as transcriptional activators in abscisic acid signaling.
    Plant Cell, 2003. 15(1): p. 63-78
    [PMID:12509522]
  5. Hiratsu K,Matsui K,Koyama T,Ohme-Takagi M
    Dominant repression of target genes by chimeric repressors that include the EAR motif, a repression domain, in Arabidopsis.
    Plant J., 2003. 34(5): p. 733-9
    [PMID:12787253]
  6. Baudry A, et al.
    TT2, TT8, and TTG1 synergistically specify the expression of BANYULS and proanthocyanidin biosynthesis in Arabidopsis thaliana.
    Plant J., 2004. 39(3): p. 366-80
    [PMID:15255866]
  7. Zimmermann IM,Heim MA,Weisshaar B,Uhrig JF
    Comprehensive identification of Arabidopsis thaliana MYB transcription factors interacting with R/B-like BHLH proteins.
    Plant J., 2004. 40(1): p. 22-34
    [PMID:15361138]
  8. Matsui K,Hiratsu K,Koyama T,Tanaka H,Ohme-Takagi M
    A chimeric AtMYB23 repressor induces hairy roots, elongation of leaves and stems, and inhibition of the deposition of mucilage on seed coats in Arabidopsis.
    Plant Cell Physiol., 2005. 46(1): p. 147-55
    [PMID:15668208]
  9. Kirik V, et al.
    Functional diversification of MYB23 and GL1 genes in trichome morphogenesis and initiation.
    Development, 2005. 132(7): p. 1477-85
    [PMID:15728674]
  10. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  11. Gao Y, et al.
    SAD2 in Arabidopsis functions in trichome initiation through mediating GL3 function and regulating GL1, TTG1 and GL2 expression.
    J Integr Plant Biol, 2008. 50(7): p. 906-17
    [PMID:18713401]
  12. Jakoby MJ, et al.
    Transcriptional profiling of mature Arabidopsis trichomes reveals that NOECK encodes the MIXTA-like transcriptional regulator MYB106.
    Plant Physiol., 2008. 148(3): p. 1583-602
    [PMID:18805951]
  13. Li SF, et al.
    The Arabidopsis MYB5 transcription factor regulates mucilage synthesis, seed coat development, and trichome morphogenesis.
    Plant Cell, 2009. 21(1): p. 72-89
    [PMID:19136646]
  14. Kang YH, et al.
    The MYB23 gene provides a positive feedback loop for cell fate specification in the Arabidopsis root epidermis.
    Plant Cell, 2009. 21(4): p. 1080-94
    [PMID:19395683]
  15. Marks MD,Wenger JP,Gilding E,Jilk R,Dixon RA
    Transcriptome analysis of Arabidopsis wild-type and gl3-sst sim trichomes identifies four additional genes required for trichome development.
    Mol Plant, 2009. 2(4): p. 803-22
    [PMID:19626137]
  16. Van Minnebruggen A, et al.
    The ang3 mutation identified the ribosomal protein gene RPL5B with a role in cell expansion during organ growth.
    Physiol Plant, 2010. 138(1): p. 91-101
    [PMID:19878482]
  17. Schliep M,Ebert B,Simon-Rosin U,Zoeller D,Fisahn J
    Quantitative expression analysis of selected transcription factors in pavement, basal and trichome cells of mature leaves from Arabidopsis thaliana.
    Protoplasma, 2010. 241(1-4): p. 29-36
    [PMID:20101514]
  18. Tominaga-Wada R, et al.
    Functional divergence of MYB-related genes, WEREWOLF and AtMYB23 in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2012. 76(5): p. 883-7
    [PMID:22738953]
  19. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]